PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g043890.1
Common NameMTR_6g043890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 343aa    MW: 39861.2 Da    PI: 8.385
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g043890.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.62e-17210292185
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                      ff  ++++ + ++++lv+p +f+++h++  ee+  + + d + r+W+v l  + ++ ++ lt+GW+eF+  n+Lk gD++ F l+
  Medtr6g043890.1 210 FFACMIKKTHIERDLLVIPTEFVKTHMHMMEEGNAILFVD-QDRTWNVDLDLTLNK-QFALTSGWSEFCAHNNLKFGDVCAFLLH 292
                      8899999*******************77777777888888.89*******554444.499**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-1710107IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.3E-1512107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.60114108IPR003340B3 DNA binding domain
CDDcd100175.78E-1114105No hitNo description
SMARTSM010194.8E-515111IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-17204293IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-17205294IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.675210306IPR003340B3 DNA binding domain
PfamPF023622.7E-14210292IPR003340B3 DNA binding domain
SMARTSM010191.7E-9210306IPR003340B3 DNA binding domain
CDDcd100174.19E-13210304No hitNo description
Gene3DG3DSA:2.40.330.100.001296325IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSSQELEHQN NGVHFFKIIL ASILQEGKLR VPINFARRHW HGITNPVTLR LPTMAQMNVT  60
WEKTSDYDVW FCNGWKEFAN YLSLRDSQLL VFRYRKKSLF DVIVFGKCGL EIKYPLRETC  120
DGSLKVTEDP SSSPGKRRKS PSPCVKVCKK MKINPEEQKE SKHEKKIFQS QAKFHNFKDM  180
NNGNSRDDIK EKSKVLYEKV NEKFSHDKDF FACMIKKTHI ERDLLVIPTE FVKTHMHMME  240
EGNAILFVDQ DRTWNVDLDL TLNKQFALTS GWSEFCAHNN LKFGDVCAFL LHKCKTTGWL  300
EFLKDCYLKE GDTCLLKMVE KACLCLILQF QEEAAKLDCV SC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452050.10.0B3 DNA-binding domain protein
TrEMBLA0A072UAG20.0A0A072UAG2_MEDTR; B3 DNA-binding domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140231017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-18B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]